PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1077s0040.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MYB
Protein Properties Length: 458aa    MW: 50614.2 Da    PI: 7.5384
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1077s0040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.2e-161461148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
         Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                            +g W++eEde+l+  ++++G g+W+++++  g+ R++k+c++rw +yl
  SapurV1A.1077s0040.1.p 14 KGLWSPEEDEKLLGHITRYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                            678*******************************************97 PP

2Myb_DNA-binding41.14.2e-1367110146
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
         Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                             rg +++ E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  SapurV1A.1077s0040.1.p  67 RGTFSQLEENLIIELHEVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                             899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-27664IPR009057Homeodomain-like
PROSITE profilePS5129417.081961IPR017930Myb domain
SuperFamilySSF466894.69E-2812108IPR009057Homeodomain-like
SMARTSM007177.8E-111363IPR001005SANT/Myb domain
PfamPF002499.0E-141461IPR001005SANT/Myb domain
CDDcd001674.64E-101761No hitNo description
PROSITE profilePS5129423.62662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-2465116IPR009057Homeodomain-like
SMARTSM007173.8E-1266114IPR001005SANT/Myb domain
PfamPF002494.3E-1267111IPR001005SANT/Myb domain
CDDcd001671.74E-869109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLGHIT RYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQLEENLIIE LHEVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQRG  120
IDPVTHKPLS EVEDGEDKNP DASRNQDKAS AVSNSELNLL KADHSEPLGA NLREKRSSSI  180
SPRGNQLERE STSSFHAMNG NGGNNLMAPT SNRDLFLDRF TAFPHEGSTS SCQPSGFGGH  240
FPLQQLNYAS NARLATNSAP SIWLSQTSKS LGMNCEFSST VIPSIPPPAV TSSFLSSSMG  300
YKPSITAPPD NPSLPSFATT SYRLWETGAP SNNSNSSTGS SGRTELQNSS SLFENAIFSW  360
GLGDCSSTEK EAQNHLIGSQ PEDIKWHEYL QNPLLMAAAL QNQNQQSLYS EIKTETHLLT  420
GNSSGMWPHN QQEQEPSQNP DICPKDMQRI TASYGYI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002302702.10.0hypothetical protein POPTR_0002s18700g
TrEMBLB9GRW70.0B9GRW7_POPTR; Uncharacterized protein
STRINGPOPTR_0002s18700.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.12e-95myb domain protein 61